HORDB

General Information

ID: hor006495
Uniprot ID: Q9ULZ1(50-77)
Protein name: Apelin-28
Gene name: APLN
Organism: Homo sapiens (Human)
Family: Apelin family
Source: Human
Expression: Expressed in the brain with highest levels in the frontal cortex, thalamus, hypothalamus and midbrain . Secreted by the mammary gland into the colostrum and the milk.
Disease: Diseases associated with APLN include Intracranial Arteriosclerosis and Heart Disease.
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0031704 apelin receptor binding
GO BP: GO:0001525 angiogenesis; GO:0006955 immune response; GO:0007165 signal transduction; GO:0007369 gastrulation; GO:0007595 lactation; GO:0010629 negative regulation of gene expression; GO:0040037 negative regulation of fibroblast growth factor receptor signaling pathway; GO:0042756 drinking behavior; GO:0045776 negative regulation of blood pressure; GO:0045823 positive regulation of heart contraction; GO:0060183 apelin receptor signaling pathway; GO:0060976 coronary vasculature development; GO:1902895 positive regulation of miRNA transcription; GO:1904022 positive regulation of G protein-coupled receptor internalization; GO:1904706 negative regulation of vascular associated smooth muscle cell proliferation; GO:1905564 positive regulation of vascular endothelial cell proliferation
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

Sequence: NGPGPWQGGRRKFRRQRPRLSHKGPMPF
Length: 28(50-77)
Propeptide: MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
Signal peptide: MNLRLCVQALLLLWLSLTAVCG
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Activity

Function: Endogenous ligand for the apelin receptor (APLNR) (PubMed:10525157). Drives internalization of the apelin receptor (By similarity). Apelin-36 dissociates more hardly than (pyroglu)apelin-13 from APLNR (By similarity). Hormone involved in the regulation of
Mechanism: NA
Cross BBB: NA
Target: APLNR
Target Unid: P35414
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure

Disulfide bond: NA
Structure ID: AF-Q9ULZ1-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006495_AF2.pdb

hor006495_ESM.pdb

Physical Information

Mass:	378357	Formula:	C146H230N54O33S
Absent amino acids:	ACDEITVY	Common amino acids:	R
pI:	13.2	Basic residues:	9
Polar residues:	7	Hydrophobic residues:	4
Hydrophobicity:	-174.64	Boman Index:	-10614
Half-Life:	1.4 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	13.93
Instability Index:	8493.57	Extinction Coefficient cystines:	5500
Absorbance 280nm:	203.7

Literature

PubMed ID: 9792798
Title: Isolation and characterization of a novel endogenous peptide ligand for the human APJ receptor.
PubMed ID: 10525157
Title: Apelin, the natural ligand of the orphan receptor APJ, is abundantly secreted in the colostrum.
PubMed ID: 10617103
Title: Characterization of apelin, the ligand for the APJ receptor.#
PubMed ID: 15772651
Title:
PubMed ID: 15489334
Title:
PubMed ID: 11090199
Title: